FOXO4-DRI
CAS 2460055-10-9
$224.00 per vial
View COAThis batch is out of stock.
Notify me when back in stock
Out of stock
FOXO4-DRI is out for this size
Leave an email and we'll send one message the moment this size is back. Optional SMS with the same heads-up. No other mail, and you can unsubscribe from that message.
- Certificate pending
- Made in Texas, USA
- Free shipping at 5 vials
- Visa and AMEX
Description
FOXO4-DRI (CAS No. 2460055-10-9) is a synthetic 46-amino-acid D-retro-inverso peptide composed entirely of D-amino acids: a 34-residue segment derived from the forkhead domain of FOXO4 fused to a 12-residue retro-inverso HIV-TAT cell-penetrating sequence. Sequence (all-D, N- to C-terminus): LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG. Molecular formula C228H388N86O64; molar mass 5358 g/mol. Supplied as lyophilized powder.
Products are sold for Research Only and not for Human Consumption.